Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA009172-25
  • Immunohistochemistry analysis in human cerebral cortex and fallopian tube tissues using HPA009172 antibody. Corresponding SLC1A2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 1 (glial high affinity glutamate transporter), member 2
Gene Name: SLC1A2
Alternative Gene Name: EAAT2, GLT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005089: 87%, ENSRNOG00000014816: 48%
Entrez Gene ID: 6506
Uniprot ID: P43004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Gene Sequence SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Gene ID - Mouse ENSMUSG00000005089
Gene ID - Rat ENSRNOG00000014816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation)
Datasheet Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC1A2 pAb (ATL-HPA009172 w/enhanced validation)