Anti SLC19A1 pAb (ATL-HPA024802)

Atlas Antibodies

Catalog No.: ATL-HPA024802-25

Protein Description: solute carrier family 19 (folate transporter), member 1
Gene Name: SLC19A1
Alternative Gene Name: FOLT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030683: 28%, ENSRNOG00000002632: 27%
Entrez Gene ID: 6573
Uniprot ID: P41440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV
• Gene Sequence: AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV
• Gene ID - Mouse: ENSMUSG00000030683
• Gene ID - Rat: ENSRNOG00000002632
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC19A1 pAb (ATL-HPA024802) – 1 Found

Lopez-Lopez, Elixabet; Autry, Robert J; Smith, Colton; Yang, Wenjian; Paugh, Steven W; Panetta, John C; Crews, Kristine R; Bonten, Erik J; Smart, Brandon; Pei, Deqing; McCorkle, J Robert; Diouf, Barthelemy; Roberts, Kathryn G; Shi, Lei; Pounds, Stanley; Cheng, Cheng; Mullighan, Charles G; Pui, Ching-Hon; Relling, Mary V; Evans, William E. Pharmacogenomics of intracellular methotrexate polyglutamates in patients' leukemia cells in vivo. The Journal Of Clinical Investigation. 2020;130(12):6600-6615.