Anti SLC17A2 pAb (ATL-HPA038270)

Atlas Antibodies

Catalog No.:
ATL-HPA038270-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 17, member 2
Gene Name: SLC17A2
Alternative Gene Name: NPT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036110: 67%, ENSRNOG00000017180: 63%
Entrez Gene ID: 10246
Uniprot ID: O00624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIIAMVNTTQQQGLSNASTEGPVADAFNNSSISIKEFDTKASVYQWSPETQG
Gene Sequence AIIAMVNTTQQQGLSNASTEGPVADAFNNSSISIKEFDTKASVYQWSPETQG
Gene ID - Mouse ENSMUSG00000036110
Gene ID - Rat ENSRNOG00000017180
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC17A2 pAb (ATL-HPA038270)
Datasheet Anti SLC17A2 pAb (ATL-HPA038270) Datasheet (External Link)
Vendor Page Anti SLC17A2 pAb (ATL-HPA038270) at Atlas Antibodies

Documents & Links for Anti SLC17A2 pAb (ATL-HPA038270)
Datasheet Anti SLC17A2 pAb (ATL-HPA038270) Datasheet (External Link)
Vendor Page Anti SLC17A2 pAb (ATL-HPA038270)