Anti SLC15A3 pAb (ATL-HPA047880)

Atlas Antibodies

Catalog No.: ATL-HPA047880-25

Protein Description: solute carrier family 15 (oligopeptide transporter), member 3
Gene Name: SLC15A3
Alternative Gene Name: hPTR3, PHT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024737: 68%, ENSRNOG00000021644: 66%
Entrez Gene ID: 51296
Uniprot ID: Q8IY34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
• Gene Sequence: PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
• Gene ID - Mouse: ENSMUSG00000024737
• Gene ID - Rat: ENSRNOG00000021644
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.