Anti SLC12A3 pAb (ATL-HPA028748 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028748-25

Protein Description: solute carrier family 12 (sodium/chloride transporter), member 3
Gene Name: SLC12A3
Alternative Gene Name: NCCT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031766: 90%, ENSRNOG00000057072: 90%
Entrez Gene ID: 6559
Uniprot ID: P55017
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
• Gene Sequence: LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
• Gene ID - Mouse: ENSMUSG00000031766
• Gene ID - Rat: ENSRNOG00000057072
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC12A3 pAb (ATL-HPA028748 w/enhanced validation) – 11 Found

Lindström, Nils O; Tran, Tracy; Guo, Jinjin; Rutledge, Elisabeth; Parvez, Riana K; Thornton, Matthew E; Grubbs, Brendan; McMahon, Jill A; McMahon, Andrew P. Conserved and Divergent Molecular and Anatomic Features of Human and Mouse Nephron Patterning. Journal Of The American Society Of Nephrology : Jasn. 2018;29(3):825-840. 

Magella, Bliss; Mahoney, Robert; Adam, Mike; Potter, S Steven. Reduced Abd-B Hox function during kidney development results in lineage infidelity. Developmental Biology. 2018;438(2):84-93. 

Zhang, Le; Ettou, Sandrine; Khalid, Myda; Taglienti, Mary; Jain, Dhawal; Jung, Youngsook L; Seager, Catherine; Liu, Yongqing; Ng, Kar-Hui; Park, Peter J; Kreidberg, Jordan A. EED, a member of the polycomb group, is required for nephron differentiation and the maintenance of nephron progenitor cells. Development (Cambridge, England). 2018;145(14) 

Frische, Sebastian; Chambrey, Régine; Trepiccione, Francesco; Zamani, Reza; Marcussen, Niels; Alexander, R Todd; Skjødt, Karsten; Svenningsen, Per; Dimke, Henrik. H(+)-ATPase B1 subunit localizes to thick ascending limb and distal convoluted tubule of rodent and human kidney. American Journal Of Physiology. Renal Physiology. 2018;315(3):F429-F444. 

Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558. 

Kamejima, Sahoko; Yamamoto, Izumi; Tajiri, Akiko; Tanno, Yudo; Ohkido, Ichiro; Yokoo, Takashi. Long-term Clinical Course after Living Kidney Donation by a Patient with Gitelman Syndrome Harboring a Compound Heterozygous Mutation of the SLC12A3 Gene. Internal Medicine (Tokyo, Japan). 2021;60(10):1567-1572. 

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. 

Marable, Sierra S; Chung, Eunah; Adam, Mike; Potter, S Steven; Park, Joo-Seop. Hnf4a deletion in the mouse kidney phenocopies Fanconi renotubular syndrome. Jci Insight. 2018;3(14) 

Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915. 

Tsukiyama, Tomoyuki; Kobayashi, Kenichi; Nakaya, Masataka; Iwatani, Chizuru; Seita, Yasunari; Tsuchiya, Hideaki; Matsushita, Jun; Kitajima, Kahoru; Kawamoto, Ikuo; Nakagawa, Takahiro; Fukuda, Koji; Iwakiri, Teppei; Izumi, Hiroyuki; Itagaki, Iori; Kume, Shinji; Maegawa, Hiroshi; Nishinakamura, Ryuichi; Nishio, Saori; Nakamura, Shinichiro; Kawauchi, Akihiro; Ema, Masatsugu. Monkeys mutant for PKD1 recapitulate human autosomal dominant polycystic kidney disease. Nature Communications. 2019;10(1):5517. 

Woloshuk, Andre; Khochare, Suraj; Almulhim, Aljohara F; McNutt, Andrew T; Dean, Dawson; Barwinska, Daria; Ferkowicz, Michael J; Eadon, Michael T; Kelly, Katherine J; Dunn, Kenneth W; Hasan, Mohammad A; El-Achkar, Tarek M; Winfree, Seth. In Situ Classification of Cell Types in Human Kidney Tissue Using 3D Nuclear Staining. Cytometry. Part A : The Journal Of The International Society For Analytical Cytology. 2021;99(7):707-721.