Anti SLC11A2 pAb (ATL-HPA032140)

Atlas Antibodies

Catalog No.: ATL-HPA032140-25

Protein Description: solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2
Gene Name: SLC11A2
Alternative Gene Name: DCT1, DMT1, NRAMP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023030: 85%, ENSRNOG00000019550: 88%
Entrez Gene ID: 4891
Uniprot ID: P49281
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKG
• Gene Sequence: TNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKG
• Gene ID - Mouse: ENSMUSG00000023030
• Gene ID - Rat: ENSRNOG00000019550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC11A2 pAb (ATL-HPA032140) – 1 Found

Lemler, David J; Lynch, Miranda L; Tesfay, Lia; Deng, Zhiyong; Paul, Bibbin T; Wang, Xiaohong; Hegde, Poornima; Manz, David H; Torti, Suzy V; Torti, Frank M. DCYTB is a predictor of outcome in breast cancer that functions via iron-independent mechanisms. Breast Cancer Research : Bcr. 2017;19(1):25.