Anti SLC11A1 pAb (ATL-HPA050378)

Atlas Antibodies

Catalog No.:
ATL-HPA050378-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 11 member 1
Gene Name: SLC11A1
Alternative Gene Name: LSH, NRAMP, NRAMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026177: 78%, ENSRNOG00000014956: 80%
Entrez Gene ID: 6556
Uniprot ID: P49279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDI
Gene Sequence FGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDI
Gene ID - Mouse ENSMUSG00000026177
Gene ID - Rat ENSRNOG00000014956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC11A1 pAb (ATL-HPA050378)
Datasheet Anti SLC11A1 pAb (ATL-HPA050378) Datasheet (External Link)
Vendor Page Anti SLC11A1 pAb (ATL-HPA050378) at Atlas Antibodies

Documents & Links for Anti SLC11A1 pAb (ATL-HPA050378)
Datasheet Anti SLC11A1 pAb (ATL-HPA050378) Datasheet (External Link)
Vendor Page Anti SLC11A1 pAb (ATL-HPA050378)