Anti SLC11A1 pAb (ATL-HPA029590)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029590-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SLC11A1
Alternative Gene Name: LSH, NRAMP, NRAMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026177: 72%, ENSRNOG00000014956: 72%
Entrez Gene ID: 6556
Uniprot ID: P49279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR |
| Gene Sequence | TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR |
| Gene ID - Mouse | ENSMUSG00000026177 |
| Gene ID - Rat | ENSRNOG00000014956 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC11A1 pAb (ATL-HPA029590) | |
| Datasheet | Anti SLC11A1 pAb (ATL-HPA029590) Datasheet (External Link) |
| Vendor Page | Anti SLC11A1 pAb (ATL-HPA029590) at Atlas Antibodies |
| Documents & Links for Anti SLC11A1 pAb (ATL-HPA029590) | |
| Datasheet | Anti SLC11A1 pAb (ATL-HPA029590) Datasheet (External Link) |
| Vendor Page | Anti SLC11A1 pAb (ATL-HPA029590) |