Anti SLC11A1 pAb (ATL-HPA029590)

Atlas Antibodies

Catalog No.: ATL-HPA029590-25

Protein Description: solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1
Gene Name: SLC11A1
Alternative Gene Name: LSH, NRAMP, NRAMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026177: 72%, ENSRNOG00000014956: 72%
Entrez Gene ID: 6556
Uniprot ID: P49279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR
• Gene Sequence: TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR
• Gene ID - Mouse: ENSMUSG00000026177
• Gene ID - Rat: ENSRNOG00000014956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.