Anti SLC10A4 pAb (ATL-HPA028835)

Atlas Antibodies

Catalog No.: ATL-HPA028835-25

Protein Description: solute carrier family 10, member 4
Gene Name: SLC10A4
Alternative Gene Name: MGC29802
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029219: 88%, ENSRNOG00000026091: 87%
Entrez Gene ID: 201780
Uniprot ID: Q96EP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTS
• Gene Sequence: LPPNCKRTVCLETGSQNVQLCTAILKLAFPPQFIGSMYMFPLLYALFQSAEAGIFVLIYKMYGSEMLHKRDPLDEDEDTDISYKKLKEEEMADTSYGTVKAENIIMMETAQTS
• Gene ID - Mouse: ENSMUSG00000029219
• Gene ID - Rat: ENSRNOG00000026091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC10A4 pAb (ATL-HPA028835) – 3 Found

Pettersson, Hanna; Zarnegar, Behdad; Westin, Annika; Persson, Viktor; Peuckert, Christiane; Jonsson, Jörgen; Hallgren, Jenny; Kullander, Klas. SLC10A4 regulates IgE-mediated mast cell degranulation in vitro and mast cell-mediated reactions in vivo. Scientific Reports. 2017;7(1):1085. 

Perry, Sharn; Larhammar, Martin; Vieillard, Jennifer; Nagaraja, Chetan; Hilscher, Markus M; Tafreshiha, Atieh; Rofo, Fadi; Caixeta, Fabio V; Kullander, Klas. Characterization of Dmrt3-Derived Neurons Suggest a Role within Locomotor Circuits. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2019;39(10):1771-1782. 

Schmidt, Stephanie; Moncada, Marcela; Burger, Simone; Geyer, Joachim. Expression, sorting and transport studies for the orphan carrier SLC10A4 in neuronal and non-neuronal cell lines and in Xenopus laevis oocytes. Bmc Neuroscience. 2015;16( 26084360):35.