Anti SIX6 pAb (ATL-HPA001403)

Atlas Antibodies

Catalog No.: ATL-HPA001403-25

Protein Description: SIX homeobox 6
Gene Name: SIX6
Alternative Gene Name: OPTX2, Six9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021099: 96%, ENSRNOG00000006296: 96%
Entrez Gene ID: 4990
Uniprot ID: O95475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI
• Gene Sequence: YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI
• Gene ID - Mouse: ENSMUSG00000021099
• Gene ID - Rat: ENSRNOG00000006296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIX6 pAb (ATL-HPA001403) – 1 Found

Xiao, Dongchang; Deng, Qinqin; Guo, Yanan; Huang, Xiuting; Zou, Min; Zhong, Jiawei; Rao, Pinhong; Xu, Zihui; Liu, Yifan; Hu, Youjin; Shen, Yin; Jin, Kangxin; Xiang, Mengqing. Generation of self-organized sensory ganglion organoids and retinal ganglion cells from fibroblasts. Science Advances. 2020;6(22):eaaz5858.