Anti SIRT5 pAb (ATL-HPA022002)

Atlas Antibodies

Catalog No.: ATL-HPA022002-25

Protein Description: sirtuin 5
Gene Name: SIRT5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054021: 91%, ENSRNOG00000017866: 90%
Entrez Gene ID: 23408
Uniprot ID: Q9NXA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW
• Gene Sequence: IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW
• Gene ID - Mouse: ENSMUSG00000054021
• Gene ID - Rat: ENSRNOG00000017866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIRT5 pAb (ATL-HPA022002) – 6 Found

Lim, Ratana; Barker, Gillian; Menon, Ramkumar; Lappas, Martha. A Novel Role for SIRT3 in Regulating Mediators Involved in the Terminal Pathways of Human Labor and Delivery. Biology Of Reproduction. 2016;95(5):95. 

Wang, Yun-Qian; Wang, Hao-Lian; Xu, Jie; Tan, Juan; Fu, Lin-Na; Wang, Ji-Lin; Zou, Tian-Hui; Sun, Dan-Feng; Gao, Qin-Yan; Chen, Ying-Xuan; Fang, Jing-Yuan. Sirtuin5 contributes to colorectal carcinogenesis by enhancing glutaminolysis in a deglutarylation-dependent manner. Nature Communications. 2018;9(1):545. 

Bhatt, Dhaval P; Mills, C Allie; Anderson, Kristin A; Henriques, Bárbara J; Lucas, Tânia G; Francisco, Sara; Liu, Juan; Ilkayeva, Olga R; Adams, Alexander E; Kulkarni, Shreyas R; Backos, Donald S; Major, Michael B; Grimsrud, Paul A; Gomes, Cláudio M; Hirschey, Matthew D. Deglutarylation of glutaryl-CoA dehydrogenase by deacylating enzyme SIRT5 promotes lysine oxidation in mice. The Journal Of Biological Chemistry. 2022;298(4):101723. 

Traba, Javier; Kwarteng-Siaw, Miriam; Okoli, Tracy C; Li, Jessica; Huffstutler, Rebecca D; Bray, Amanda; Waclawiw, Myron A; Han, Kim; Pelletier, Martin; Sauve, Anthony A; Siegel, Richard M; Sack, Michael N. Fasting and refeeding differentially regulate NLRP3 inflammasome activation in human subjects. The Journal Of Clinical Investigation. 2015;125(12):4592-600. 

Lu, Wenqing; Che, Xiaofang; Qu, Xiujuan; Zheng, Chunlei; Yang, Xianghong; Bao, Bowen; Li, Zhi; Wang, Duo; Jin, Yue; Wang, Yizhe; Xiao, Jiawen; Qi, Jianfei; Liu, Yunpeng. Succinylation Regulators Promote Clear Cell Renal Cell Carcinoma by Immune Regulation and RNA N6-Methyladenosine Methylation. Frontiers In Cell And Developmental Biology. 9( 33681201):622198. 

Haschler, Timo N; Horsley, Harry; Balys, Monika; Anderson, Glenn; Taanman, Jan-Willem; Unwin, Robert J; Norman, Jill T. Sirtuin 5 depletion impairs mitochondrial function in human proximal tubular epithelial cells. Scientific Reports. 2021;11(1):15510.