Anti SIRT2 pAb (ATL-HPA011165)

Atlas Antibodies

Catalog No.: ATL-HPA011165-25

Protein Description: sirtuin 2
Gene Name: SIRT2
Alternative Gene Name: SIR2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015149: 83%, ENSRNOG00000020102: 83%
Entrez Gene ID: 22933
Uniprot ID: Q8IXJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
• Gene Sequence: KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
• Gene ID - Mouse: ENSMUSG00000015149
• Gene ID - Rat: ENSRNOG00000020102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIRT2 pAb (ATL-HPA011165) – 4 Found

Wilking-Busch, Melissa Jean; Ndiaye, Mary Ann; Huang, Wei; Ahmad, Nihal. Expression profile of SIRT2 in human melanoma and implications for sirtuin-based chemotherapy. Cell Cycle (Georgetown, Tex.). 2017;16(6):574-577. 

Xu, Lei; Wang, Lei; Zhou, Lixing; Dorfman, Robert Gregory; Pan, Yida; Tang, Dehua; Wang, Yuming; Yin, Yuyao; Jiang, Chengfei; Zou, Xiaoping; Wu, Jianlin; Zhang, Mingming. The SIRT2/cMYC Pathway Inhibits Peroxidation-Related Apoptosis In Cholangiocarcinoma Through Metabolic Reprogramming. Neoplasia (New York, N.y.). 2019;21(5):429-441. 

Ma, L; Maruwge, W; Strambi, A; D'Arcy, P; Pellegrini, P; Kis, L; de Milito, A; Lain, S; Brodin, B. SIRT1 and SIRT2 inhibition impairs pediatric soft tissue sarcoma growth. Cell Death & Disease. 2014;5(10):e1483. 

Du, Yanhua; Wu, Jun; Zhang, Haiyan; Li, Shaobo; Sun, Hong. Reduced expression of SIRT2 in serous ovarian carcinoma promotes cell proliferation through disinhibition of CDK4 expression. Molecular Medicine Reports. 2017;15(4):1638-1646.