Anti SIRPB1 pAb (ATL-HPA047463)

Atlas Antibodies

Catalog No.:
ATL-HPA047463-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: signal-regulatory protein beta 1
Gene Name: SIRPB1
Alternative Gene Name: CD172b, SIRP-BETA-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030374: 34%, ENSRNOG00000000040: 34%
Entrez Gene ID: 10326
Uniprot ID: O00241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Gene Sequence VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Gene ID - Mouse ENSMUSG00000030374
Gene ID - Rat ENSRNOG00000000040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SIRPB1 pAb (ATL-HPA047463)
Datasheet Anti SIRPB1 pAb (ATL-HPA047463) Datasheet (External Link)
Vendor Page Anti SIRPB1 pAb (ATL-HPA047463) at Atlas Antibodies

Documents & Links for Anti SIRPB1 pAb (ATL-HPA047463)
Datasheet Anti SIRPB1 pAb (ATL-HPA047463) Datasheet (External Link)
Vendor Page Anti SIRPB1 pAb (ATL-HPA047463)