Anti SIRPB1 pAb (ATL-HPA047463)

Atlas Antibodies

Catalog No.: ATL-HPA047463-25

Protein Description: signal-regulatory protein beta 1
Gene Name: SIRPB1
Alternative Gene Name: CD172b, SIRP-BETA-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030374: 34%, ENSRNOG00000000040: 34%
Entrez Gene ID: 10326
Uniprot ID: O00241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSKSYALEISAHQKEHGSDITHEPALAPTAPL
• Gene Sequence: VSKSYALEISAHQKEHGSDITHEPALAPTAPL
• Gene ID - Mouse: ENSMUSG00000030374
• Gene ID - Rat: ENSRNOG00000000040
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.