Anti SIK1 pAb (ATL-HPA038211)

Atlas Antibodies

Catalog No.: ATL-HPA038211-25

Protein Description: salt-inducible kinase 1
Gene Name: SIK1
Alternative Gene Name: msk, SNF1LK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024042: 71%, ENSRNOG00000001189: 71%
Entrez Gene ID: 150094
Uniprot ID: P57059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF
• Gene Sequence: YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF
• Gene ID - Mouse: ENSMUSG00000024042
• Gene ID - Rat: ENSRNOG00000001189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SIK1 pAb (ATL-HPA038211) – 1 Found

Vanlandewijck, Michael; Dadras, Mahsa Shahidi; Lomnytska, Marta; Mahzabin, Tanzila; Lee Miller, Martin; Busch, Christer; Brunak, Søren; Heldin, Carl-Henrik; Moustakas, Aristidis. The protein kinase SIK downregulates the polarity protein Par3. Oncotarget. 2018;9(5):5716-5735.