Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018002-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SIGMAR1
Alternative Gene Name: OPRS1, SR-BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036078: 98%, ENSRNOG00000014604: 100%
Entrez Gene ID: 10280
Uniprot ID: Q99720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG |
| Gene Sequence | FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG |
| Gene ID - Mouse | ENSMUSG00000036078 |
| Gene ID - Rat | ENSRNOG00000014604 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) | |
| Datasheet | Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) | |
| Datasheet | Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) |
| Citations for Anti SIGMAR1 pAb (ATL-HPA018002 w/enhanced validation) – 10 Found |
| Avalle, Lidia; Camporeale, Annalisa; Morciano, Giampaolo; Caroccia, Natascia; Ghetti, Elena; Orecchia, Valeria; Viavattene, Daniele; Giorgi, Carlotta; Pinton, Paolo; Poli, Valeria. STAT3 localizes to the ER, acting as a gatekeeper for ER-mitochondrion Ca(2+) fluxes and apoptotic responses. Cell Death And Differentiation. 2019;26(5):932-942. PubMed |
| Chiabrando, Deborah; Marro, Samuele; Mercurio, Sonia; Giorgi, Carlotta; Petrillo, Sara; Vinchi, Francesca; Fiorito, Veronica; Fagoonee, Sharmila; Camporeale, Annalisa; Turco, Emilia; Merlo, Giorgio R; Silengo, Lorenzo; Altruda, Fiorella; Pinton, Paolo; Tolosano, Emanuela. The mitochondrial heme exporter FLVCR1b mediates erythroid differentiation. The Journal Of Clinical Investigation. 2012;122(12):4569-79. PubMed |
| Sun, Bing; Kawahara, Masahiro; Nagamune, Teruyuki. Modeling tandem AAG8-MEK inhibition in melanoma cells. Cancer Medicine. 2014;3(3):710-8. PubMed |
| Radif, Yassmeen; Ndiaye, Haarith; Kalantzi, Vasiliki; Jacobs, Ruth; Hall, Andrew; Minogue, Shane; Waugh, Mark G. The endogenous subcellular localisations of the long chain fatty acid-activating enzymes ACSL3 and ACSL4 in sarcoma and breast cancer cells. Molecular And Cellular Biochemistry. 2018;448(1-2):275-286. PubMed |
| La Morgia, Chiara; Maresca, Alessandra; Amore, Giulia; Gramegna, Laura Ludovica; Carbonelli, Michele; Scimonelli, Emanuela; Danese, Alberto; Patergnani, Simone; Caporali, Leonardo; Tagliavini, Francesca; Del Dotto, Valentina; Capristo, Mariantonietta; Sadun, Federico; Barboni, Piero; Savini, Giacomo; Evangelisti, Stefania; Bianchini, Claudio; Valentino, Maria Lucia; Liguori, Rocco; Tonon, Caterina; Giorgi, Carlotta; Pinton, Paolo; Lodi, Raffaele; Carelli, Valerio. Calcium mishandling in absence of primary mitochondrial dysfunction drives cellular pathology in Wolfram Syndrome. Scientific Reports. 2020;10(1):4785. PubMed |
| Lau, Dawn H W; Paillusson, Sebastien; Hartopp, Naomi; Rupawala, Huzefa; Mórotz, Gábor M; Gomez-Suaga, Patricia; Greig, Jenny; Troakes, Claire; Noble, Wendy; Miller, Christopher C J. Disruption of endoplasmic reticulum-mitochondria tethering proteins in post-mortem Alzheimer's disease brain. Neurobiology Of Disease. 2020;143( 32682953):105020. PubMed |
| Genovese, Ilaria; Giamogante, Flavia; Barazzuol, Lucia; Battista, Theo; Fiorillo, Annarita; Vicario, Mattia; D'Alessandro, Giuseppina; Cipriani, Raffaela; Limatola, Cristina; Rossi, Daniela; Sorrentino, Vincenzo; Poser, Elena; Mosca, Luciana; Squitieri, Ferdinando; Perluigi, Marzia; Arena, Andrea; van Petegem, Filip; Tito, Claudia; Fazi, Francesco; Giorgi, Carlotta; Calì, Tito; Ilari, Andrea; Colotti, Gianni. Sorcin is an early marker of neurodegeneration, Ca(2+) dysregulation and endoplasmic reticulum stress associated to neurodegenerative diseases. Cell Death & Disease. 2020;11(10):861. PubMed |
| Rodríguez, Laura R; Calap-Quintana, Pablo; Lapeña-Luzón, Tamara; Pallardó, Federico V; Schneuwly, Stephan; Navarro, Juan A; Gonzalez-Cabo, Pilar. Oxidative stress modulates rearrangement of endoplasmic reticulum-mitochondria contacts and calcium dysregulation in a Friedreich's ataxia model. Redox Biology. 2020;37( 33128998):101762. PubMed |
| Missiroli, Sonia; Perrone, Mariasole; Gafà, Roberta; Nicoli, Francesco; Bonora, Massimo; Morciano, Giampaolo; Boncompagni, Caterina; Marchi, Saverio; Lebiedzinska-Arciszewska, Magdalena; Vezzani, Bianca; Lanza, Giovanni; Kricek, Franz; Borghi, Alessandro; Fiorica, Francesco; Ito, Keisuke; Wieckowski, Mariusz R; Di Virgilio, Francesco; Abelli, Luigi; Pinton, Paolo; Giorgi, Carlotta. PML at mitochondria-associated membranes governs a trimeric complex with NLRP3 and P2X7R that modulates the tumor immune microenvironment. Cell Death And Differentiation. 2023;30(2):429-441. PubMed |
| Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304. PubMed |