Anti SIGLEC10 pAb (ATL-HPA027093)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027093-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SIGLEC10
Alternative Gene Name: MGC126774, PRO940, SIGLEC-10, SLG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030468: 47%, ENSRNOG00000037331: 47%
Entrez Gene ID: 89790
Uniprot ID: Q96LC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQY |
| Gene Sequence | DGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQY |
| Gene ID - Mouse | ENSMUSG00000030468 |
| Gene ID - Rat | ENSRNOG00000037331 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SIGLEC10 pAb (ATL-HPA027093) | |
| Datasheet | Anti SIGLEC10 pAb (ATL-HPA027093) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC10 pAb (ATL-HPA027093) at Atlas Antibodies |
| Documents & Links for Anti SIGLEC10 pAb (ATL-HPA027093) | |
| Datasheet | Anti SIGLEC10 pAb (ATL-HPA027093) Datasheet (External Link) |
| Vendor Page | Anti SIGLEC10 pAb (ATL-HPA027093) |
| Citations for Anti SIGLEC10 pAb (ATL-HPA027093) – 1 Found |
| Kim, Dong Won; Tu, Kevin J; Wei, Alice; Lau, Ashley J; Gonzalez-Gil, Anabel; Cao, Tianyu; Braunstein, Kerstin; Ling, Jonathan P; Troncoso, Juan C; Wong, Philip C; Blackshaw, Seth; Schnaar, Ronald L; Li, Tong. Amyloid-beta and tau pathologies act synergistically to induce novel disease stage-specific microglia subtypes. Molecular Neurodegeneration. 2022;17(1):83. PubMed |