Anti SHANK1 pAb (ATL-HPA032130)

Atlas Antibodies

Catalog No.: ATL-HPA032130-25

Protein Description: SH3 and multiple ankyrin repeat domains 1
Gene Name: SHANK1
Alternative Gene Name: SPANK-1, SSTRIP, synamon
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038738: 99%, ENSRNOG00000019207: 99%
Entrez Gene ID: 50944
Uniprot ID: Q9Y566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPGPGGLASLGKHRPKGFFATESSFDPHHR
• Gene Sequence: LRSKSMTSELEEMEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPGPGGLASLGKHRPKGFFATESSFDPHHR
• Gene ID - Mouse: ENSMUSG00000038738
• Gene ID - Rat: ENSRNOG00000019207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.