Anti SH3RF3 pAb (ATL-HPA048444)

Atlas Antibodies

Catalog No.:
ATL-HPA048444-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SH3 domain containing ring finger 3
Gene Name: SH3RF3
Alternative Gene Name: FLJ00204, POSH2, SH3MD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037990: 84%, ENSRNOG00000046791: 84%
Entrez Gene ID: 344558
Uniprot ID: Q8TEJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LISSSDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELE
Gene Sequence LISSSDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELE
Gene ID - Mouse ENSMUSG00000037990
Gene ID - Rat ENSRNOG00000046791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH3RF3 pAb (ATL-HPA048444)
Datasheet Anti SH3RF3 pAb (ATL-HPA048444) Datasheet (External Link)
Vendor Page Anti SH3RF3 pAb (ATL-HPA048444) at Atlas Antibodies

Documents & Links for Anti SH3RF3 pAb (ATL-HPA048444)
Datasheet Anti SH3RF3 pAb (ATL-HPA048444) Datasheet (External Link)
Vendor Page Anti SH3RF3 pAb (ATL-HPA048444)