Anti SH3BP4 pAb (ATL-HPA037533)

Atlas Antibodies

Catalog No.:
ATL-HPA037533-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: SH3-domain binding protein 4
Gene Name: SH3BP4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036206: 97%, ENSRNOG00000019316: 97%
Entrez Gene ID: 23677
Uniprot ID: Q9P0V3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT
Gene Sequence EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT
Gene ID - Mouse ENSMUSG00000036206
Gene ID - Rat ENSRNOG00000019316
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH3BP4 pAb (ATL-HPA037533)
Datasheet Anti SH3BP4 pAb (ATL-HPA037533) Datasheet (External Link)
Vendor Page Anti SH3BP4 pAb (ATL-HPA037533) at Atlas Antibodies

Documents & Links for Anti SH3BP4 pAb (ATL-HPA037533)
Datasheet Anti SH3BP4 pAb (ATL-HPA037533) Datasheet (External Link)
Vendor Page Anti SH3BP4 pAb (ATL-HPA037533)