Anti SH2B3 pAb (ATL-HPA005483)

Atlas Antibodies

Catalog No.: ATL-HPA005483-25

Protein Description: SH2B adaptor protein 3
Gene Name: SH2B3
Alternative Gene Name: IDDM20, LNK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042594: 79%, ENSRNOG00000028198: 77%
Entrez Gene ID: 10019
Uniprot ID: Q9UQQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
• Gene Sequence: FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
• Gene ID - Mouse: ENSMUSG00000042594
• Gene ID - Rat: ENSRNOG00000028198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH2B3 pAb (ATL-HPA005483) – 2 Found

Flister, Michael J; Endres, Bradley T; Rudemiller, Nathan; Sarkis, Allison B; Santarriaga, Stephanie; Roy, Ishan; Lemke, Angela; Geurts, Aron M; Moreno, Carol; Ran, Sophia; Tsaih, Shirng-Wern; De Pons, Jeffery; Carlson, Daniel F; Tan, Wenfang; Fahrenkrug, Scott C; Lazarova, Zelmira; Lazar, Jozef; North, Paula E; LaViolette, Peter S; Dwinell, Michael B; Shull, James D; Jacob, Howard J. CXM: a new tool for mapping breast cancer risk in the tumor microenvironment. Cancer Research. 2014;74(22):6419-29. 

Ibrahim, El-Sayed H; Baruah, Dhiraj; Croisille, Pierre; Stojanovska, Jadranka; Rubenstein, Jason C; Frei, Anne; Schlaak, Rachel A; Lin, Chieh-Yu; Pipke, Jamie L; Lemke, Angela; Xu, Zhiqiang; Klaas, Amanda; Brehler, Michael; Flister, Michael J; Laviolette, Peter S; Gore, Elizabeth M; Bergom, Carmen. Cardiac Magnetic Resonance for Early Detection of Radiation Therapy-Induced Cardiotoxicity in a Small Animal Model. Jacc. Cardiooncology. 2021;3(1):113-130.