Anti SGK494 pAb (ATL-HPA046590)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046590-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: SGK494
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037593: 64%, ENSRNOG00000037214: 69%
Entrez Gene ID: 124923
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLP |
Gene Sequence | MGAVSCRQGQHTQQGEHTRVAVPHKQGGNIRGPWARGWKSLWTGLGTIRSDLEELWELRGHHYLHQESLKPAPVLVEKPLP |
Gene ID - Mouse | ENSMUSG00000037593 |
Gene ID - Rat | ENSRNOG00000037214 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SGK494 pAb (ATL-HPA046590) | |
Datasheet | Anti SGK494 pAb (ATL-HPA046590) Datasheet (External Link) |
Vendor Page | Anti SGK494 pAb (ATL-HPA046590) at Atlas Antibodies |
Documents & Links for Anti SGK494 pAb (ATL-HPA046590) | |
Datasheet | Anti SGK494 pAb (ATL-HPA046590) Datasheet (External Link) |
Vendor Page | Anti SGK494 pAb (ATL-HPA046590) |