Anti SFRP4 pAb (ATL-HPA009712 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA009712-25

Protein Description: secreted frizzled-related protein 4
Gene Name: SFRP4
Alternative Gene Name: FRP-4, frpHE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021319: 97%, ENSRNOG00000054957: 96%
Entrez Gene ID: 6424
Uniprot ID: Q6FHJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
• Gene Sequence: RHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKR
• Gene ID - Mouse: ENSMUSG00000021319
• Gene ID - Rat: ENSRNOG00000054957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SFRP4 pAb (ATL-HPA009712 w/enhanced validation) – 5 Found

Ten Dam, Evert-Jan P M; van Beuge, Marike M; Bank, Ruud A; Werker, Paul M N. Further evidence of the involvement of the Wnt signaling pathway in Dupuytren's disease. Journal Of Cell Communication And Signaling. 2016;10(1):33-40. 

Ren, Yi A; Liu, Zhilin; Mullany, Lisa K; Fan, Chen-Ming; Richards, JoAnne S. Growth Arrest Specific-1 (GAS1) Is a C/EBP Target Gene That Functions in Ovulation and Corpus Luteum Formation in Mice. Biology Of Reproduction. 2016;94(2):44. 

Wilson, Kalin; Park, Jiyeon; Curry, Thomas E Jr; Mishra, Birendra; Gossen, Jan; Taniuchi, Ichiro; Jo, Misung. Core Binding Factor-β Knockdown Alters Ovarian Gene Expression and Function in the Mouse. Molecular Endocrinology (Baltimore, Md.). 2016;30(7):733-47. 

Lee-Thacker, Somang; Choi, Yohan; Taniuchi, Ichiro; Takarada, Takeshi; Yoneda, Yukio; Ko, CheMyong; Jo, Misung. Core Binding Factor β Expression in Ovarian Granulosa Cells Is Essential for Female Fertility. Endocrinology. 2018;159(5):2094-2109. 

Lee-Thacker, Somang; Jeon, Hayce; Choi, Yohan; Taniuchi, Ichiro; Takarada, Takeshi; Yoneda, Yukio; Ko, CheMyong; Jo, Misung. Core Binding Factors are essential for ovulation, luteinization, and female fertility in mice. Scientific Reports. 2020;10(1):9921.