Anti SFMBT2 pAb (ATL-HPA035448)

Atlas Antibodies

Catalog No.:
ATL-HPA035448-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Scm-like with four mbt domains 2
Gene Name: SFMBT2
Alternative Gene Name: KIAA1617
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061186: 91%, ENSRNOG00000029235: 70%
Entrez Gene ID: 57713
Uniprot ID: Q5VUG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFWCDVVIADLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQN
Gene Sequence DFWCDVVIADLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQN
Gene ID - Mouse ENSMUSG00000061186
Gene ID - Rat ENSRNOG00000029235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFMBT2 pAb (ATL-HPA035448)
Datasheet Anti SFMBT2 pAb (ATL-HPA035448) Datasheet (External Link)
Vendor Page Anti SFMBT2 pAb (ATL-HPA035448) at Atlas Antibodies

Documents & Links for Anti SFMBT2 pAb (ATL-HPA035448)
Datasheet Anti SFMBT2 pAb (ATL-HPA035448) Datasheet (External Link)
Vendor Page Anti SFMBT2 pAb (ATL-HPA035448)