Anti SF1 pAb (ATL-HPA018883)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018883-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SF1
Alternative Gene Name: ZCCHC25, ZFM1, ZNF162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106722: 99%, ENSRNOG00000021085: 99%
Entrez Gene ID: 7536
Uniprot ID: Q15637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLI |
| Gene Sequence | NQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLI |
| Gene ID - Mouse | ENSMUSG00000106722 |
| Gene ID - Rat | ENSRNOG00000021085 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SF1 pAb (ATL-HPA018883) | |
| Datasheet | Anti SF1 pAb (ATL-HPA018883) Datasheet (External Link) |
| Vendor Page | Anti SF1 pAb (ATL-HPA018883) at Atlas Antibodies |
| Documents & Links for Anti SF1 pAb (ATL-HPA018883) | |
| Datasheet | Anti SF1 pAb (ATL-HPA018883) Datasheet (External Link) |
| Vendor Page | Anti SF1 pAb (ATL-HPA018883) |
| Citations for Anti SF1 pAb (ATL-HPA018883) – 4 Found |
| Arosh, Joe A; Lee, JeHoon; Balasubbramanian, Dakshnapriya; Stanley, Jone A; Long, Charles R; Meagher, Mary W; Osteen, Kevin G; Bruner-Tran, Kaylon L; Burghardt, Robert C; Starzinski-Powitz, Anna; Banu, Sakhila K. Molecular and preclinical basis to inhibit PGE2 receptors EP2 and EP4 as a novel nonsteroidal therapy for endometriosis. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(31):9716-21. PubMed |
| Heintz, Caroline; Doktor, Thomas Koed; Lanjuin, Anne; Escoubas, Caroline; Zhang, Yue; Weir, Heather J; Dutta, Sneha; Silva-García, Carlos Giovanni; Bruun, Gitte Hoffmann; Morantte, Ianessa; Hoxhaj, Gerta; Manning, Brendan D; Andresen, Brage S; Mair, William B. Splicing factor 1 modulates dietary restriction and TORC1 pathway longevity in C. elegans. Nature. 2017;541(7635):102-106. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Jackson, Travis C; Du, Lina; Janesko-Feldman, Keri; Vagni, Vincent A; Dezfulian, Cameron; Poloyac, Samuel M; Jackson, Edwin K; Clark, Robert S B; Kochanek, Patrick M. The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice. Journal Of Cerebral Blood Flow And Metabolism : Official Journal Of The International Society Of Cerebral Blood Flow And Metabolism. 2015;35(4):655-66. PubMed |