Anti SETX pAb (ATL-HPA024105)

Atlas Antibodies

Catalog No.:
ATL-HPA024105-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: senataxin
Gene Name: SETX
Alternative Gene Name: ALS4, AOA2, KIAA0625, SCAR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043535: 85%, ENSRNOG00000013491: 86%
Entrez Gene ID: 23064
Uniprot ID: Q7Z333
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEVLWELETLRLINHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFEN
Gene Sequence CCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEVLWELETLRLINHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFEN
Gene ID - Mouse ENSMUSG00000043535
Gene ID - Rat ENSRNOG00000013491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SETX pAb (ATL-HPA024105)
Datasheet Anti SETX pAb (ATL-HPA024105) Datasheet (External Link)
Vendor Page Anti SETX pAb (ATL-HPA024105) at Atlas Antibodies

Documents & Links for Anti SETX pAb (ATL-HPA024105)
Datasheet Anti SETX pAb (ATL-HPA024105) Datasheet (External Link)
Vendor Page Anti SETX pAb (ATL-HPA024105)