Anti SETD6 pAb (ATL-HPA041481)

Atlas Antibodies

Catalog No.: ATL-HPA041481-25

Protein Description: SET domain containing 6
Gene Name: SETD6
Alternative Gene Name: FLJ21148
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031671: 88%, ENSRNOG00000012447: 90%
Entrez Gene ID: 79918
Uniprot ID: Q8TBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN
• Gene Sequence: LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN
• Gene ID - Mouse: ENSMUSG00000031671
• Gene ID - Rat: ENSRNOG00000012447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SETD6 pAb (ATL-HPA041481) – 1 Found

Mukherjee, Neelam; Cardenas, Eduardo; Bedolla, Roble; Ghosh, Rita. SETD6 regulates NF-κB signaling in urothelial cell survival: Implications for bladder cancer. Oncotarget. 2017;8(9):15114-15125.