Anti SETD6 pAb (ATL-HPA041481)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041481-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SETD6
Alternative Gene Name: FLJ21148
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031671: 88%, ENSRNOG00000012447: 90%
Entrez Gene ID: 79918
Uniprot ID: Q8TBK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN |
| Gene Sequence | LLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN |
| Gene ID - Mouse | ENSMUSG00000031671 |
| Gene ID - Rat | ENSRNOG00000012447 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SETD6 pAb (ATL-HPA041481) | |
| Datasheet | Anti SETD6 pAb (ATL-HPA041481) Datasheet (External Link) |
| Vendor Page | Anti SETD6 pAb (ATL-HPA041481) at Atlas Antibodies |
| Documents & Links for Anti SETD6 pAb (ATL-HPA041481) | |
| Datasheet | Anti SETD6 pAb (ATL-HPA041481) Datasheet (External Link) |
| Vendor Page | Anti SETD6 pAb (ATL-HPA041481) |
| Citations for Anti SETD6 pAb (ATL-HPA041481) – 1 Found |
| Mukherjee, Neelam; Cardenas, Eduardo; Bedolla, Roble; Ghosh, Rita. SETD6 regulates NF-κB signaling in urothelial cell survival: Implications for bladder cancer. Oncotarget. 2017;8(9):15114-15125. PubMed |