Anti SERPINH1 pAb (ATL-HPA029198 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029198-100

Protein Description: serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Gene Name: SERPINH1
Alternative Gene Name: CBP1, CBP2, colligen, HSP47, SERPINH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070436: 89%, ENSRNOG00000016831: 88%
Entrez Gene ID: 871
Uniprot ID: P50454
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
• Gene Sequence: LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
• Gene ID - Mouse: ENSMUSG00000070436
• Gene ID - Rat: ENSRNOG00000016831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINH1 pAb (ATL-HPA029198 w/enhanced validation) – 1 Found

Macken, William L; Godwin, Annie; Wheway, Gabrielle; Stals, Karen; Nazlamova, Liliya; Ellard, Sian; Alfares, Ahmed; Aloraini, Taghrid; AlSubaie, Lamia; Alfadhel, Majid; Alajaji, Sulaiman; Wai, Htoo A; Self, Jay; Douglas, Andrew G L; Kao, Alexander P; Guille, Matthew; Baralle, Diana. Biallelic variants in COPB1 cause a novel, severe intellectual disability syndrome with cataracts and variable microcephaly. Genome Medicine. 2021;13(1):34.