Anti SERPINB6 pAb (ATL-HPA009668 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA009668-25

Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 6
Gene Name: SERPINB6
Alternative Gene Name: CAP, DFNB91, PI6, PTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060147: 75%, ENSRNOG00000016420: 71%
Entrez Gene ID: 5269
Uniprot ID: P35237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSV
• Gene Sequence: FALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSV
• Gene ID - Mouse: ENSMUSG00000060147
• Gene ID - Rat: ENSRNOG00000016420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINB6 pAb (ATL-HPA009668 w/enhanced validation) – 1 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.