Anti SERPINA1 pAb (ATL-HPA000927 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000927-25

Protein Description: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Gene Name: SERPINA1
Alternative Gene Name: A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071178: 62%, ENSRNOG00000032669: 67%
Entrez Gene ID: 5265
Uniprot ID: P01009
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
• Gene Sequence: HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
• Gene ID - Mouse: ENSMUSG00000071178
• Gene ID - Rat: ENSRNOG00000032669
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINA1 pAb (ATL-HPA000927 w/enhanced validation) – 3 Found

Kwon, Chae Hwa; Park, Hye Ji; Choi, Jin Hwa; Lee, Ja Rang; Kim, Hye Kyung; Jo, Hong-Jae; Kim, Hyun Sung; Oh, Nahmgun; Song, Geun Am; Park, Do Youn. Snail and serpinA1 promote tumor progression and predict prognosis in colorectal cancer. Oncotarget. 2015;6(24):20312-26. 

Kwon, C H; Park, H J; Lee, J R; Kim, H K; Jeon, T Y; Jo, H-J; Kim, D H; Kim, G H; Park, D Y. Serpin peptidase inhibitor clade A member 1 is a biomarker of poor prognosis in gastric cancer. British Journal Of Cancer. 2014;111(10):1993-2002. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.