Anti SERINC3 pAb (ATL-HPA048116)

Atlas Antibodies

Catalog No.:
ATL-HPA048116-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: serine incorporator 3
Gene Name: SERINC3
Alternative Gene Name: AIGP1, DIFF33, SBBI99, TDE, TDE1, TMS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017707: 68%, ENSRNOG00000009552: 65%
Entrez Gene ID: 10955
Uniprot ID: Q13530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK
Gene Sequence EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK
Gene ID - Mouse ENSMUSG00000017707
Gene ID - Rat ENSRNOG00000009552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERINC3 pAb (ATL-HPA048116)
Datasheet Anti SERINC3 pAb (ATL-HPA048116) Datasheet (External Link)
Vendor Page Anti SERINC3 pAb (ATL-HPA048116) at Atlas Antibodies

Documents & Links for Anti SERINC3 pAb (ATL-HPA048116)
Datasheet Anti SERINC3 pAb (ATL-HPA048116) Datasheet (External Link)
Vendor Page Anti SERINC3 pAb (ATL-HPA048116)