Anti SERINC3 pAb (ATL-HPA048116)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048116-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SERINC3
Alternative Gene Name: AIGP1, DIFF33, SBBI99, TDE, TDE1, TMS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017707: 68%, ENSRNOG00000009552: 65%
Entrez Gene ID: 10955
Uniprot ID: Q13530
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK |
Gene Sequence | EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK |
Gene ID - Mouse | ENSMUSG00000017707 |
Gene ID - Rat | ENSRNOG00000009552 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SERINC3 pAb (ATL-HPA048116) | |
Datasheet | Anti SERINC3 pAb (ATL-HPA048116) Datasheet (External Link) |
Vendor Page | Anti SERINC3 pAb (ATL-HPA048116) at Atlas Antibodies |
Documents & Links for Anti SERINC3 pAb (ATL-HPA048116) | |
Datasheet | Anti SERINC3 pAb (ATL-HPA048116) Datasheet (External Link) |
Vendor Page | Anti SERINC3 pAb (ATL-HPA048116) |