Anti SERINC1 pAb (ATL-HPA035738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035738-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: SERINC1
Alternative Gene Name: KIAA1253, TDE1L, TDE2, TMS-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019877: 84%, ENSRNOG00000029360: 88%
Entrez Gene ID: 57515
Uniprot ID: Q9NRX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ |
| Gene Sequence | TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ |
| Gene ID - Mouse | ENSMUSG00000019877 |
| Gene ID - Rat | ENSRNOG00000029360 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SERINC1 pAb (ATL-HPA035738) | |
| Datasheet | Anti SERINC1 pAb (ATL-HPA035738) Datasheet (External Link) |
| Vendor Page | Anti SERINC1 pAb (ATL-HPA035738) at Atlas Antibodies |
| Documents & Links for Anti SERINC1 pAb (ATL-HPA035738) | |
| Datasheet | Anti SERINC1 pAb (ATL-HPA035738) Datasheet (External Link) |
| Vendor Page | Anti SERINC1 pAb (ATL-HPA035738) |
| Citations for Anti SERINC1 pAb (ATL-HPA035738) – 1 Found |
| Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304. PubMed |