Anti SERINC1 pAb (ATL-HPA035738)

Atlas Antibodies

Catalog No.:
ATL-HPA035738-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: serine incorporator 1
Gene Name: SERINC1
Alternative Gene Name: KIAA1253, TDE1L, TDE2, TMS-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019877: 84%, ENSRNOG00000029360: 88%
Entrez Gene ID: 57515
Uniprot ID: Q9NRX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ
Gene Sequence TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ
Gene ID - Mouse ENSMUSG00000019877
Gene ID - Rat ENSRNOG00000029360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERINC1 pAb (ATL-HPA035738)
Datasheet Anti SERINC1 pAb (ATL-HPA035738) Datasheet (External Link)
Vendor Page Anti SERINC1 pAb (ATL-HPA035738) at Atlas Antibodies

Documents & Links for Anti SERINC1 pAb (ATL-HPA035738)
Datasheet Anti SERINC1 pAb (ATL-HPA035738) Datasheet (External Link)
Vendor Page Anti SERINC1 pAb (ATL-HPA035738)
Citations for Anti SERINC1 pAb (ATL-HPA035738) – 1 Found
Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304.  PubMed