Anti SERGEF pAb (ATL-HPA037812)

Atlas Antibodies

Catalog No.:
ATL-HPA037812-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: secretion regulating guanine nucleotide exchange factor
Gene Name: SERGEF
Alternative Gene Name: DelGEF, Gnefr
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030839: 72%, ENSRNOG00000011488: 70%
Entrez Gene ID: 26297
Uniprot ID: Q9UGK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATEVSCGSEHNLAIIGGVCYSWGWNEH
Gene Sequence WTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATEVSCGSEHNLAIIGGVCYSWGWNEH
Gene ID - Mouse ENSMUSG00000030839
Gene ID - Rat ENSRNOG00000011488
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERGEF pAb (ATL-HPA037812)
Datasheet Anti SERGEF pAb (ATL-HPA037812) Datasheet (External Link)
Vendor Page Anti SERGEF pAb (ATL-HPA037812) at Atlas Antibodies

Documents & Links for Anti SERGEF pAb (ATL-HPA037812)
Datasheet Anti SERGEF pAb (ATL-HPA037812) Datasheet (External Link)
Vendor Page Anti SERGEF pAb (ATL-HPA037812)