Anti SEPT9 pAb (ATL-HPA050627)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050627-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SEPT9
Alternative Gene Name: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SeptD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059248: 75%, ENSRNOG00000002807: 77%
Entrez Gene ID: 10801
Uniprot ID: Q9UHD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS |
Gene Sequence | PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS |
Gene ID - Mouse | ENSMUSG00000059248 |
Gene ID - Rat | ENSRNOG00000002807 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEPT9 pAb (ATL-HPA050627) | |
Datasheet | Anti SEPT9 pAb (ATL-HPA050627) Datasheet (External Link) |
Vendor Page | Anti SEPT9 pAb (ATL-HPA050627) at Atlas Antibodies |
Documents & Links for Anti SEPT9 pAb (ATL-HPA050627) | |
Datasheet | Anti SEPT9 pAb (ATL-HPA050627) Datasheet (External Link) |
Vendor Page | Anti SEPT9 pAb (ATL-HPA050627) |