Anti SEPT6 pAb (ATL-HPA003459)

Atlas Antibodies

Catalog No.: ATL-HPA003459-25

Protein Description: septin 6
Gene Name: SEPT6
Alternative Gene Name: KIAA0128, MGC16619, MGC20339, SEP2, SEPT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058013: 100%, ENSRNOG00000002182: 100%
Entrez Gene ID: 23157
Uniprot ID: Q14141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQ
• Gene Sequence: KSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQ
• Gene ID - Mouse: ENSMUSG00000058013
• Gene ID - Rat: ENSRNOG00000002182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEPT6 pAb (ATL-HPA003459) – 2 Found

Banko, Monika; Mucha-Kruczynska, Iwona; Weise, Christoph; Heyd, Florian; Ewers, Helge. A homozygous genome-edited Sept2-EGFP fibroblast cell line. Cytoskeleton (Hoboken, N.j.). 2019;76(1):73-82. 

Froidevaux-Klipfel, Laurence; Poirier, Florence; Boursier, Céline; Crépin, Ronan; Poüs, Christian; Baudin, Bruno; Baillet, Anita. Modulation of septin and molecular motor recruitment in the microtubule environment of the Taxol-resistant human breast cancer cell line MDA-MB-231. Proteomics. 2011;11(19):3877-86.