Anti SENP2 pAb (ATL-HPA029248)

Atlas Antibodies

Catalog No.: ATL-HPA029248-25

Protein Description: SUMO1/sentrin/SMT3 specific peptidase 2
Gene Name: SENP2
Alternative Gene Name: AXAM2, DKFZp762A2316, KIAA1331, SMT3IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022855: 82%, ENSRNOG00000001773: 85%
Entrez Gene ID: 59343
Uniprot ID: Q9HC62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKL
• Gene Sequence: RRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKL
• Gene ID - Mouse: ENSMUSG00000022855
• Gene ID - Rat: ENSRNOG00000001773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SENP2 pAb (ATL-HPA029248) – 1 Found

Wang, Jing; Qian, Jun; Hoeksema, Megan D; Zou, Yong; Espinosa, Allan V; Rahman, S M Jamshedur; Zhang, Bing; Massion, Pierre P. Integrative genomics analysis identifies candidate drivers at 3q26-29 amplicon in squamous cell carcinoma of the lung. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2013;19(20):5580-90.