Anti SENP2 pAb (ATL-HPA029247)

Atlas Antibodies

Catalog No.:
ATL-HPA029247-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: SUMO1/sentrin/SMT3 specific peptidase 2
Gene Name: SENP2
Alternative Gene Name: AXAM2, DKFZp762A2316, KIAA1331, SMT3IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022855: 73%, ENSRNOG00000001773: 70%
Entrez Gene ID: 59343
Uniprot ID: Q9HC62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENES
Gene Sequence SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENES
Gene ID - Mouse ENSMUSG00000022855
Gene ID - Rat ENSRNOG00000001773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SENP2 pAb (ATL-HPA029247)
Datasheet Anti SENP2 pAb (ATL-HPA029247) Datasheet (External Link)
Vendor Page Anti SENP2 pAb (ATL-HPA029247) at Atlas Antibodies

Documents & Links for Anti SENP2 pAb (ATL-HPA029247)
Datasheet Anti SENP2 pAb (ATL-HPA029247) Datasheet (External Link)
Vendor Page Anti SENP2 pAb (ATL-HPA029247)