Anti SENP2 pAb (ATL-HPA029247)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029247-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SENP2
Alternative Gene Name: AXAM2, DKFZp762A2316, KIAA1331, SMT3IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022855: 73%, ENSRNOG00000001773: 70%
Entrez Gene ID: 59343
Uniprot ID: Q9HC62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENES |
| Gene Sequence | SGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENES |
| Gene ID - Mouse | ENSMUSG00000022855 |
| Gene ID - Rat | ENSRNOG00000001773 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SENP2 pAb (ATL-HPA029247) | |
| Datasheet | Anti SENP2 pAb (ATL-HPA029247) Datasheet (External Link) |
| Vendor Page | Anti SENP2 pAb (ATL-HPA029247) at Atlas Antibodies |
| Documents & Links for Anti SENP2 pAb (ATL-HPA029247) | |
| Datasheet | Anti SENP2 pAb (ATL-HPA029247) Datasheet (External Link) |
| Vendor Page | Anti SENP2 pAb (ATL-HPA029247) |