Anti SEMA4D pAb (ATL-HPA023277)

Atlas Antibodies

Catalog No.:
ATL-HPA023277-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Gene Name: SEMA4D
Alternative Gene Name: C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051107: 73%, ENSRNOG00000013679: 75%
Entrez Gene ID: 10507
Uniprot ID: Q92854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCSVLSSAGNKTSKVQVAVMRPEVTHQERWTRELSAWRAVAGEHDRMMQSWRKAWESCSKDTL
Gene Sequence RCSVLSSAGNKTSKVQVAVMRPEVTHQERWTRELSAWRAVAGEHDRMMQSWRKAWESCSKDTL
Gene ID - Mouse ENSMUSG00000051107
Gene ID - Rat ENSRNOG00000013679
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEMA4D pAb (ATL-HPA023277)
Datasheet Anti SEMA4D pAb (ATL-HPA023277) Datasheet (External Link)
Vendor Page Anti SEMA4D pAb (ATL-HPA023277) at Atlas Antibodies

Documents & Links for Anti SEMA4D pAb (ATL-HPA023277)
Datasheet Anti SEMA4D pAb (ATL-HPA023277) Datasheet (External Link)
Vendor Page Anti SEMA4D pAb (ATL-HPA023277)