Anti SEMA4D pAb (ATL-HPA015662)

Atlas Antibodies

Catalog No.: ATL-HPA015662-25

Protein Description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Gene Name: SEMA4D
Alternative Gene Name: C9orf164, CD100, coll-4, FLJ39737, SEMAJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021451: 92%, ENSRNOG00000013679: 90%
Entrez Gene ID: 10507
Uniprot ID: Q92854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
• Gene Sequence: LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
• Gene ID - Mouse: ENSMUSG00000021451
• Gene ID - Rat: ENSRNOG00000013679
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEMA4D pAb (ATL-HPA015662) – 1 Found

Ikeya, Tetsuro; Maeda, Kiyoshi; Nagahara, Hisashi; Shibutani, Masatsune; Iseki, Yasuhito; Hirakawa, Kosei. The combined expression of Semaphorin4D and PlexinB1 predicts disease recurrence in colorectal cancer. Bmc Cancer. 2016;16( 27456345):525.