Anti SEMA3G pAb (ATL-HPA001761)

Atlas Antibodies

Catalog No.:
ATL-HPA001761-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3G
Gene Name: SEMA3G
Alternative Gene Name: FLJ00014, sem2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021904: 75%, ENSRNOG00000018952: 74%
Entrez Gene ID: 56920
Uniprot ID: Q9NS98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG
Gene Sequence VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG
Gene ID - Mouse ENSMUSG00000021904
Gene ID - Rat ENSRNOG00000018952
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEMA3G pAb (ATL-HPA001761)
Datasheet Anti SEMA3G pAb (ATL-HPA001761) Datasheet (External Link)
Vendor Page Anti SEMA3G pAb (ATL-HPA001761) at Atlas Antibodies

Documents & Links for Anti SEMA3G pAb (ATL-HPA001761)
Datasheet Anti SEMA3G pAb (ATL-HPA001761) Datasheet (External Link)
Vendor Page Anti SEMA3G pAb (ATL-HPA001761)
Citations for Anti SEMA3G pAb (ATL-HPA001761) – 3 Found
Ishibashi, Ryoichi; Takemoto, Minoru; Akimoto, Yoshihiro; Ishikawa, Takahiro; He, Peng; Maezawa, Yoshiro; Sakamoto, Kenichi; Tsurutani, Yuya; Ide, Shintaro; Ide, Kana; Kawamura, Harukiyo; Kobayashi, Kazuki; Tokuyama, Hirotake; Tryggvason, Karl; Betsholtz, Christer; Yokote, Koutaro. A novel podocyte gene, semaphorin 3G, protects glomerular podocyte from lipopolysaccharide-induced inflammation. Scientific Reports. 2016;6( 27180624):25955.  PubMed
Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70.  PubMed
Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481.  PubMed