Anti SEM1 pAb (ATL-HPA072648)

Atlas Antibodies

Catalog No.:
ATL-HPA072648-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SEM1, 26S proteasome complex subunit
Gene Name: SEM1
Alternative Gene Name: DSS1, ECD, SHFD1, Shfdg1, SHFM1, SHSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042541: 100%, ENSRNOG00000010420: 100%
Entrez Gene ID: 7979
Uniprot ID: P60896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED
Gene Sequence MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED
Gene ID - Mouse ENSMUSG00000042541
Gene ID - Rat ENSRNOG00000010420
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEM1 pAb (ATL-HPA072648)
Datasheet Anti SEM1 pAb (ATL-HPA072648) Datasheet (External Link)
Vendor Page Anti SEM1 pAb (ATL-HPA072648) at Atlas Antibodies

Documents & Links for Anti SEM1 pAb (ATL-HPA072648)
Datasheet Anti SEM1 pAb (ATL-HPA072648) Datasheet (External Link)
Vendor Page Anti SEM1 pAb (ATL-HPA072648)