Anti SEM1 pAb (ATL-HPA072648)

Atlas Antibodies

Catalog No.: ATL-HPA072648-25

Protein Description: SEM1, 26S proteasome complex subunit
Gene Name: SEM1
Alternative Gene Name: DSS1, ECD, SHFD1, Shfdg1, SHFM1, SHSF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042541: 100%, ENSRNOG00000010420: 100%
Entrez Gene ID: 7979
Uniprot ID: P60896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED
• Gene Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED
• Gene ID - Mouse: ENSMUSG00000042541
• Gene ID - Rat: ENSRNOG00000010420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.