Anti SELL pAb (ATL-HPA051972)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051972-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: SELL
Alternative Gene Name: CD62L, hLHRc, LAM-1, LAM1, Leu-8, LNHR, LSEL, Lyam-1, LYAM1, PLNHR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026581: 58%, ENSRNOG00000002776: 60%
Entrez Gene ID: 6402
Uniprot ID: P14151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD |
Gene Sequence | MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD |
Gene ID - Mouse | ENSMUSG00000026581 |
Gene ID - Rat | ENSRNOG00000002776 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SELL pAb (ATL-HPA051972) | |
Datasheet | Anti SELL pAb (ATL-HPA051972) Datasheet (External Link) |
Vendor Page | Anti SELL pAb (ATL-HPA051972) at Atlas Antibodies |
Documents & Links for Anti SELL pAb (ATL-HPA051972) | |
Datasheet | Anti SELL pAb (ATL-HPA051972) Datasheet (External Link) |
Vendor Page | Anti SELL pAb (ATL-HPA051972) |