Anti SELENOS pAb (ATL-HPA010025 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010025-25

Protein Description: selenoprotein S
Gene Name: SELENOS
Alternative Gene Name: AD-015, MGC2553, SBBI8, SELS, SEPS1, VIMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075701: 86%, ENSRNOG00000012576: 86%
Entrez Gene ID: 55829
Uniprot ID: Q9BQE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
• Gene Sequence: EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
• Gene ID - Mouse: ENSMUSG00000075701
• Gene ID - Rat: ENSRNOG00000012576
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SELENOS pAb (ATL-HPA010025 w/enhanced validation) – 7 Found

Wright, Craig Robert; Allsopp, Giselle Larissa; Addinsall, Alex Bernard; McRae, Natasha Lee; Andrikopoulos, Sofianos; Stupka, Nicole. A Reduction in Selenoprotein S Amplifies the Inflammatory Profile of Fast-Twitch Skeletal Muscle in the mdx Dystrophic Mouse. Mediators Of Inflammation. 2017( 28592916):7043429. 

Paavilainen, Linda; Edvinsson, Asa; Asplund, Anna; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Wester, Kenneth. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2010;58(3):237-46. 

Bubenik, Jodi L; Miniard, Angela C; Driscoll, Donna M. Alternative transcripts and 3'UTR elements govern the incorporation of selenocysteine into selenoprotein S. Plos One. 8(4):e62102. 

Touat-Hamici, Zahia; Legrain, Yona; Bulteau, Anne-Laure; Chavatte, Laurent. Selective up-regulation of human selenoproteins in response to oxidative stress. The Journal Of Biological Chemistry. 2014;289(21):14750-61. 

Santos, Liliana R; Durães, Cecília; Ziros, Panos G; Pestana, Ana; Esteves, César; Neves, Celestino; Carvalho, Davide; Bongiovanni, Massimo; Renaud, Cédric O; Chartoumpekis, Dionysios V; Habeos, Ioannis G; Simões, Manuel Sobrinho; Soares, Paula; Sykiotis, Gerasimos P. Interaction of Genetic Variations in NFE2L2 and SELENOS Modulates the Risk of Hashimoto's Thyroiditis. Thyroid : Official Journal Of The American Thyroid Association. 2019;29(9):1302-1315. 

Cockman, Eric M; Narayan, Vivek; Willard, Belinda; Shetty, Sumangala P; Copeland, Paul R; Driscoll, Donna M. Identification of the Selenoprotein S Positive UGA Recoding (SPUR) element and its position-dependent activity. Rna Biology. 2019;16(12):1682-1696. 

Leonardi, Andrea; Kovalchuk, Nataliia; Yin, Lei; Endres, Lauren; Evke, Sara; Nevins, Steven; Martin, Samuel; Dedon, Peter C; Melendez, J Andres; Van Winkle, Laura; Zhang, Qing-Yu; Ding, Xinxin; Begley, Thomas J. The epitranscriptomic writer ALKBH8 drives tolerance and protects mouse lungs from the environmental pollutant naphthalene. Epigenetics. 2020;15(10):1121-1138.