Anti SEC62 pAb (ATL-HPA061450)
Atlas Antibodies
- SKU:
- ATL-HPA061450-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SEC62
Alternative Gene Name: Dtrp1, HTP1, TLOC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027706: 98%, ENSRNOG00000009057: 98%
Entrez Gene ID: 7095
Uniprot ID: Q99442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKK |
Gene Sequence | MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKK |
Gene ID - Mouse | ENSMUSG00000027706 |
Gene ID - Rat | ENSRNOG00000009057 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEC62 pAb (ATL-HPA061450) | |
Datasheet | Anti SEC62 pAb (ATL-HPA061450) Datasheet (External Link) |
Vendor Page | Anti SEC62 pAb (ATL-HPA061450) at Atlas Antibodies |
Documents & Links for Anti SEC62 pAb (ATL-HPA061450) | |
Datasheet | Anti SEC62 pAb (ATL-HPA061450) Datasheet (External Link) |
Vendor Page | Anti SEC62 pAb (ATL-HPA061450) |