Anti SEC62 pAb (ATL-HPA061450)

Atlas Antibodies

SKU:
ATL-HPA061450-25
  • Immunohistochemical staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SEC62 homolog (S. cerevisiae)
Gene Name: SEC62
Alternative Gene Name: Dtrp1, HTP1, TLOC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027706: 98%, ENSRNOG00000009057: 98%
Entrez Gene ID: 7095
Uniprot ID: Q99442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKK
Gene Sequence MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKK
Gene ID - Mouse ENSMUSG00000027706
Gene ID - Rat ENSRNOG00000009057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEC62 pAb (ATL-HPA061450)
Datasheet Anti SEC62 pAb (ATL-HPA061450) Datasheet (External Link)
Vendor Page Anti SEC62 pAb (ATL-HPA061450) at Atlas Antibodies

Documents & Links for Anti SEC62 pAb (ATL-HPA061450)
Datasheet Anti SEC62 pAb (ATL-HPA061450) Datasheet (External Link)
Vendor Page Anti SEC62 pAb (ATL-HPA061450)