Anti SEC16A pAb (ATL-HPA005684)

Atlas Antibodies

Catalog No.: ATL-HPA005684-25

Protein Description: SEC16 homolog A (S. cerevisiae)
Gene Name: SEC16A
Alternative Gene Name: KIAA0310, p250
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026924: 46%, ENSRNOG00000019122: 47%
Entrez Gene ID: 9919
Uniprot ID: O15027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
• Gene Sequence: PLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKAPGDLPAAGGPPSGAMPFYNPAQ
• Gene ID - Mouse: ENSMUSG00000026924
• Gene ID - Rat: ENSRNOG00000019122
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEC16A pAb (ATL-HPA005684) – 3 Found

Liu, Jennifer Y; Lin, Yu-Hsiu Tony; Leidal, Andrew M; Huang, Hector H; Ye, Jordan; Wiita, Arun P; Debnath, Jayanta. GRASP55 restricts early-stage autophagy and regulates spatial organization of the early secretory network. Biology Open. 2021;10(10) 

Wu, Yan; Guo, Xiao Peng; Kanemoto, Soshi; Maeoka, Yujiro; Saito, Atsushi; Asada, Rie; Matsuhisa, Koji; Ohtake, Yosuke; Imaizumi, Kazunori; Kaneko, Masayuki. Sec16A, a key protein in COPII vesicle formation, regulates the stability and localization of the novel ubiquitin ligase RNF183. Plos One. 13(1):e0190407. 

Cendrowski, Jaroslaw; Kaczmarek, Marta; Mazur, Michał; Kuzmicz-Kowalska, Katarzyna; Jastrzebski, Kamil; Brewinska-Olchowik, Marta; Kominek, Agata; Piwocka, Katarzyna; Miaczynska, Marta. Splicing variation of BMP2K balances abundance of COPII assemblies and autophagic degradation in erythroid cells. Elife. 2020;9( 32795391)