Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026816-25
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/86110/157063/atl-hpa026816_anti-sec11c-pab-atl-hpa026816-wenhanced-validation_38696__49370.1681107923.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SEC11C
Alternative Gene Name: SEC11L3, SPC21, SPCS4C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024516: 88%, ENSRNOG00000017036: 88%
Entrez Gene ID: 90701
Uniprot ID: Q9BY50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV |
| Gene Sequence | MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV |
| Gene ID - Mouse | ENSMUSG00000024516 |
| Gene ID - Rat | ENSRNOG00000017036 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) | |
| Datasheet | Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) | |
| Datasheet | Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) |
| Citations for Anti SEC11C pAb (ATL-HPA026816 w/enhanced validation) – 1 Found |
| Zhang, Rong; Miner, Jonathan J; Gorman, Matthew J; Rausch, Keiko; Ramage, Holly; White, James P; Zuiani, Adam; Zhang, Ping; Fernandez, Estefania; Zhang, Qiang; Dowd, Kimberly A; Pierson, Theodore C; Cherry, Sara; Diamond, Michael S. A CRISPR screen defines a signal peptide processing pathway required by flaviviruses. Nature. 2016;535(7610):164-8. PubMed |