Anti SDCBP pAb (ATL-HPA023840 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023840-100

Protein Description: syndecan binding protein (syntenin)
Gene Name: SDCBP
Alternative Gene Name: SYCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028249: 88%, ENSRNOG00000009683: 89%
Entrez Gene ID: 6386
Uniprot ID: O00560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSI
• Gene Sequence: ANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSI
• Gene ID - Mouse: ENSMUSG00000028249
• Gene ID - Rat: ENSRNOG00000009683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SDCBP pAb (ATL-HPA023840 w/enhanced validation) – 1 Found

Kegelman, Timothy P; Das, Swadesh K; Hu, Bin; Bacolod, Manny D; Fuller, Christine E; Menezes, Mitchell E; Emdad, Luni; Dasgupta, Santanu; Baldwin, Albert S; Bruce, Jeffrey N; Dent, Paul; Pellecchia, Maurizio; Sarkar, Devanand; Fisher, Paul B. MDA-9/syntenin is a key regulator of glioma pathogenesis. Neuro-Oncology. 2014;16(1):50-61.