Anti SCRIB pAb (ATL-HPA023557 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023557-25

Protein Description: scribbled planar cell polarity protein
Gene Name: SCRIB
Alternative Gene Name: KIAA0147, SCRB1, Vartul
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022568: 75%, ENSRNOG00000032574: 74%
Entrez Gene ID: 23513
Uniprot ID: Q14160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
• Gene Sequence: VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
• Gene ID - Mouse: ENSMUSG00000022568
• Gene ID - Rat: ENSRNOG00000032574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCRIB pAb (ATL-HPA023557 w/enhanced validation) – 1 Found

Saito, Yasuhiro; Matsuda, Shiori; Ohnishi, Naomi; Endo, Keiko; Ashitani, Sanae; Ohishi, Maki; Ueno, Ayano; Tomita, Masaru; Ueda, Koji; Soga, Tomoyoshi; Muthuswamy, Senthil K. Polarity protein SCRIB interacts with SLC3A2 to regulate proliferation and tamoxifen resistance in ER+ breast cancer. Communications Biology. 2022;5(1):403.