Anti SCP2 pAb (ATL-HPA027135 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027135-25

Protein Description: sterol carrier protein 2
Gene Name: SCP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028603: 85%, ENSRNOG00000011413: 83%
Entrez Gene ID: 6342
Uniprot ID: P22307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH
• Gene Sequence: GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH
• Gene ID - Mouse: ENSMUSG00000028603
• Gene ID - Rat: ENSRNOG00000011413
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCP2 pAb (ATL-HPA027135 w/enhanced validation) – 1 Found

Ranea-Robles, Pablo; Portman, Kensey; Bender, Aaron; Lee, Kyung; He, John Cijiang; Mulholland, David J; Argmann, Carmen; Houten, Sander M. Peroxisomal L-bifunctional protein (EHHADH) deficiency causes male-specific kidney hypertrophy and proximal tubular injury in mice. Kidney360. 2021;2(9):1441-1454.