Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015612-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SCNN1B
Alternative Gene Name: ENaCbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030873: 87%, ENSRNOG00000030981: 88%
Entrez Gene ID: 6338
Uniprot ID: P51168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS |
| Gene Sequence | GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS |
| Gene ID - Mouse | ENSMUSG00000030873 |
| Gene ID - Rat | ENSRNOG00000030981 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) | |
| Datasheet | Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) | |
| Datasheet | Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) |
| Citations for Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) – 2 Found |
| Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245. PubMed |
| Guidone, Daniela; Buccirossi, Martina; Scudieri, Paolo; Genovese, Michele; Sarnataro, Sergio; De Cegli, Rossella; Cresta, Federico; Terlizzi, Vito; Planelles, Gabrielle; Crambert, Gilles; Sermet, Isabelle; Galietta, Luis Jv. Airway surface hyperviscosity and defective mucociliary transport by IL-17/TNF-α are corrected by β-adrenergic stimulus. Jci Insight. 2022;7(22) PubMed |