Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA015612-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sodium channel, non-voltage-gated 1, beta subunit
Gene Name: SCNN1B
Alternative Gene Name: ENaCbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030873: 87%, ENSRNOG00000030981: 88%
Entrez Gene ID: 6338
Uniprot ID: P51168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS
Gene Sequence GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS
Gene ID - Mouse ENSMUSG00000030873
Gene ID - Rat ENSRNOG00000030981
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation)
Datasheet Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation)
Datasheet Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation)
Citations for Anti SCNN1B pAb (ATL-HPA015612 w/enhanced validation) – 2 Found
Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245.  PubMed
Guidone, Daniela; Buccirossi, Martina; Scudieri, Paolo; Genovese, Michele; Sarnataro, Sergio; De Cegli, Rossella; Cresta, Federico; Terlizzi, Vito; Planelles, Gabrielle; Crambert, Gilles; Sermet, Isabelle; Galietta, Luis Jv. Airway surface hyperviscosity and defective mucociliary transport by IL-17/TNF-α are corrected by β-adrenergic stimulus. Jci Insight. 2022;7(22)  PubMed