Anti SCN11A pAb (ATL-HPA036746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036746-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SCN11A
Alternative Gene Name: NaN, Nav1.9, SCN12A, SNS-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034115: 53%, ENSRNOG00000032884: 56%
Entrez Gene ID: 11280
Uniprot ID: Q9UI33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME |
| Gene Sequence | EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME |
| Gene ID - Mouse | ENSMUSG00000034115 |
| Gene ID - Rat | ENSRNOG00000032884 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCN11A pAb (ATL-HPA036746) | |
| Datasheet | Anti SCN11A pAb (ATL-HPA036746) Datasheet (External Link) |
| Vendor Page | Anti SCN11A pAb (ATL-HPA036746) at Atlas Antibodies |
| Documents & Links for Anti SCN11A pAb (ATL-HPA036746) | |
| Datasheet | Anti SCN11A pAb (ATL-HPA036746) Datasheet (External Link) |
| Vendor Page | Anti SCN11A pAb (ATL-HPA036746) |