Anti SCN11A pAb (ATL-HPA036746)

Atlas Antibodies

Catalog No.:
ATL-HPA036746-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sodium channel, voltage-gated, type XI, alpha subunit
Gene Name: SCN11A
Alternative Gene Name: NaN, Nav1.9, SCN12A, SNS-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034115: 53%, ENSRNOG00000032884: 56%
Entrez Gene ID: 11280
Uniprot ID: Q9UI33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME
Gene Sequence EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME
Gene ID - Mouse ENSMUSG00000034115
Gene ID - Rat ENSRNOG00000032884
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCN11A pAb (ATL-HPA036746)
Datasheet Anti SCN11A pAb (ATL-HPA036746) Datasheet (External Link)
Vendor Page Anti SCN11A pAb (ATL-HPA036746) at Atlas Antibodies

Documents & Links for Anti SCN11A pAb (ATL-HPA036746)
Datasheet Anti SCN11A pAb (ATL-HPA036746) Datasheet (External Link)
Vendor Page Anti SCN11A pAb (ATL-HPA036746)